PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 141aa    MW: 16011.1 Da    PI: 8.073
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16115.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB160.42.7e-50499297
       NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 eqdr lPianvsrimk++lP  akisk+ k+++qecv+efisfvt+easdkc++e+rkt+ngdd++wal++lGf++y+e++  yl+kyr++e+ek
  KHN16115.1  4 DEQDRALPIANVSRIMKQILPPSAKISKEGKQVMQECVTEFISFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYAEAIGRYLHKYRQAEREK 99
                59*******************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.7E-483109IPR009072Histone-fold
SuperFamilySSF471131.86E-376112IPR009072Histone-fold
PfamPF008083.8E-25973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-183755No hitNo description
PROSITE patternPS0068504056IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-185674No hitNo description
PRINTSPR006151.4E-187593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MDQDEQDRAL PIANVSRIMK QILPPSAKIS KEGKQVMQEC VTEFISFVTG EASDKCHKEN  60
RKTVNGDDIC WALSSLGFDN YAEAIGRYLH KYRQAEREKI NHDKKYENPH INRAPPPPLL  120
LSRVTRDKVE NPPPSPPNQS G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-42594392Transcription factor HapC (Eurofung)
4g92_B2e-42594392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2359140.0AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535337.11e-103PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040271e-55NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0B2Q4881e-103A0A0B2Q488_GLYSO; Nuclear transcription factor Y subunit B-4
TrEMBLK7LJK21e-103K7LJK2_SOYBN; Uncharacterized protein
STRINGGLYMA10G29440.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.18e-57nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]